Protein Info for AZOBR_RS19020 in Azospirillum brasilense Sp245

Annotation: multidrug ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 transmembrane" amino acids 39 to 61 (23 residues), see Phobius details amino acids 70 to 96 (27 residues), see Phobius details amino acids 116 to 142 (27 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 181 to 202 (22 residues), see Phobius details amino acids 208 to 229 (22 residues), see Phobius details amino acids 236 to 256 (21 residues), see Phobius details PF01061: ABC2_membrane" amino acids 20 to 229 (210 residues), 107.5 bits, see alignment E=7.1e-35 PF12698: ABC2_membrane_3" amino acids 69 to 256 (188 residues), 32.6 bits, see alignment E=4.7e-12

Best Hits

Swiss-Prot: 39% identical to YADH_ECOLI: Inner membrane transport permease YadH (yadH) from Escherichia coli (strain K12)

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 84% identity to azl:AZL_004190)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AT54 at UniProt or InterPro

Protein Sequence (267 amino acids)

>AZOBR_RS19020 multidrug ABC transporter permease (Azospirillum brasilense Sp245)
MTHPLPPMPRQVGAVNWVGLWTLYAREVRRFLKVHQQTVWAPVVTTLLFYAVFALALGGA
VRMIGTVPYLEFLAPGLIMMAMAQNAFANTSSSVVIAKVQGNIVDILMPPMAPLELVFGF
VMGGVTRGLIVGLVTGLAIWAFVPVRIAHPEFVIFHALMASMLLSLLGLVGGIWSEKFDN
IAAVTNFVVTPLSFLSGTFYSVETLPPVFWWIAHFDPFFYMIDGFRYGFIGRSDGTLGIG
ILVMLAVNGGLWWLAWRMLKTGYKLKA