Protein Info for AZOBR_RS18835 in Azospirillum brasilense Sp245

Annotation: 3-beta-hydroxy-delta(5)-steroid dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 PF01370: Epimerase" amino acids 8 to 216 (209 residues), 76.9 bits, see alignment E=5.9e-25 PF05368: NmrA" amino acids 8 to 129 (122 residues), 49.2 bits, see alignment E=1.8e-16 PF04321: RmlD_sub_bind" amino acids 8 to 238 (231 residues), 50.2 bits, see alignment E=7e-17 PF03435: Sacchrp_dh_NADP" amino acids 10 to 83 (74 residues), 31.5 bits, see alignment E=7.2e-11 PF01073: 3Beta_HSD" amino acids 10 to 204 (195 residues), 59.6 bits, see alignment E=8.9e-20 PF13460: NAD_binding_10" amino acids 12 to 156 (145 residues), 64.3 bits, see alignment E=4.8e-21 PF07993: NAD_binding_4" amino acids 119 to 171 (53 residues), 22.3 bits, see alignment 2.3e-08

Best Hits

KEGG orthology group: K00329, NADH dehydrogenase [EC: 1.6.5.3] K00356, NADH dehydrogenase [EC: 1.6.99.3] (inferred from 69% identity to azl:AZL_001030)

Predicted SEED Role

"NAD-dependent epimerase/dehydratase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3, 1.6.99.3

Use Curated BLAST to search for 1.6.5.3 or 1.6.99.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AT14 at UniProt or InterPro

Protein Sequence (329 amino acids)

>AZOBR_RS18835 3-beta-hydroxy-delta(5)-steroid dehydrogenase (Azospirillum brasilense Sp245)
MSYRSEVVTVFGGSGFVGRHLIRRLAKTGAIVRVVSRHPNKANFLKTAGSVGQIVPMAAD
VKDDQSVARAIQGADTVINLIGTLYERGAWNFQTVHVDAPARIARIAKASGVRRLVHVSA
IGADAKSASAYAKSKAAGEQAVAQAFPGATIVRPSIVFGPEDGFFNKFAAMAQVSPALPL
IGGSTKFQPVYVGDLADAIAAAATLDSAVGRTFELGGPRVYSFKELMQLMLREIRRKRFL
VPVPWNIAETLGGLLEKVPPIVAPPLTRDQVEMLRTDNVAAAGAPGFKELGITNLSSCEV
ILPTYLSRFIVGGRSNTMPRDAGNHSGAH