Protein Info for AZOBR_RS18585 in Azospirillum brasilense Sp245

Annotation: peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 PF18348: SH3_16" amino acids 19 to 63 (45 residues), 38 bits, see alignment 1.7e-13 PF00877: NLPC_P60" amino acids 154 to 242 (89 residues), 56.6 bits, see alignment E=3.4e-19

Best Hits

KEGG orthology group: None (inferred from 64% identity to azl:AZL_e03460)

Predicted SEED Role

"NLP/P60 family lipoprotein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8ASU6 at UniProt or InterPro

Protein Sequence (263 amino acids)

>AZOBR_RS18585 peptidase (Azospirillum brasilense Sp245)
MTDAQTTPIRRLAAPQAVLLEQPRHGVPQTSEMLFGETCTPLDRDGDWVKVENRTDGHVG
WLPPGTDLTEPVAPTHRVSGRVANLHPAPTHKAVPMAALSFGSLVTVAEQADAQFPGGWV
RLDNGLWTFGKLLEPVAVPPNRVPVETALRFLETPYVWGGRSAFGIDCSGLVQVALRAAG
ITTHHSSGMQRNDDRLGPMVSADGQGVDYRRGDIVFFPGHVGIMLDGATLLHATVFTMSV
VTEPLADVAARAEGITGVRRPFF