Protein Info for AZOBR_RS18560 in Azospirillum brasilense Sp245

Updated annotation (from data): ABC transporter for nitrate, periplasmic substrate-binding component
Rationale: Specific phenotype on Sodium nitrate. (SEED_correct)
Original annotation: nitrate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF13379: NMT1_2" amino acids 33 to 309 (277 residues), 324.1 bits, see alignment E=8.1e-101 PF09084: NMT1" amino acids 45 to 87 (43 residues), 22.9 bits, see alignment 7.5e-09

Best Hits

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 86% identity to azl:AZL_e03510)

Predicted SEED Role

"Nitrate ABC transporter, nitrate-binding protein" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8ASU1 at UniProt or InterPro

Protein Sequence (461 amino acids)

>AZOBR_RS18560 ABC transporter for nitrate, periplasmic substrate-binding component (Azospirillum brasilense Sp245)
IRLPASPRTALLSAAATLALMLGSAQAAPLDVEKDQLKLGFIKLTDMAPLAIAAEKGFFE
DEGLSVTLEPQANWKVLLDRVISGELDGAHMLAGQPLGATIGFGTQANVVTAFSMDLNGN
GITLSNEVWERMKPNLPKGPDGKPLHPIKADALKPVIAQYRAEGKPFTMGMVFPVSTHNY
ELRYWLAAGGINPGYYAPNDVSGQIQADALLSVTPPPQMPATLEAGTIFGYSVGEPWNQQ
AVMKGIGVPVITDTEIWKNNPEKVFGVTEGWAAKNPKTHLALVKALIRAAMWLDENGNAN
RAEAVKILAKSEYVGADAKVIANSMTGTFEYEKGDKRAVPDFNVFFRYNATYPFYSDAVW
YLTQMRRWGQIAEAKPDAWYDETARKVYKPEIYLKAARLLVEEGKAKEADFPWTSDGYKP
LDNGFIDGIAYDGRKPNEYLTKLPIGLKGGQAVQGGQLVGG