Protein Info for AZOBR_RS18555 in Azospirillum brasilense Sp245

Updated annotation (from data): ABC transporter for nitrate, permease component
Rationale: Specific phenotypes on Sodium nitrate; Sodium nitrate. Other substrates proposed by KEGG )sulfonate and taurine) were not tested. (KEGG_correct)
Original annotation: nitrate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 transmembrane" amino acids 28 to 50 (23 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 162 to 184 (23 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details amino acids 230 to 252 (23 residues), see Phobius details amino acids 282 to 308 (27 residues), see Phobius details amino acids 328 to 346 (19 residues), see Phobius details PF00528: BPD_transp_1" amino acids 174 to 357 (184 residues), 80.4 bits, see alignment E=7.3e-27

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 84% identity to azl:AZL_e03520)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8ASU0 at UniProt or InterPro

Protein Sequence (363 amino acids)

>AZOBR_RS18555 ABC transporter for nitrate, permease component (Azospirillum brasilense Sp245)
MTSVTEASTLSSAEAMRARRKARLAHALNRTAATLQIVGLGWLSPLLRMAAGDSPRQQGQ
ELWQQMGVPLTALMLFLAAWAWLAPQVNTSLGAIPGPAQVWEQIGILHADHKAERAKEAA
FYDRQAKRNAELLAKDPAAEVKTRPYAGKPTYLDQILTSLKTVFTGFLLGALVAVPLGVA
CGLSRTVNAAMNPLIQIFKPVSPLAWLPLVTMVVSATVSSDNPTFEKSFLTSAVTVTLCS
LWPTLINTAVGVSSIDKDLMNVGKVLQLSGPTMVRRLVLPSALPYIFTGLRLSLGVGWMV
LIAAEMLAQNPGLGKFVWDEFQNGSSSSLARIMVAVFTIGLIGFLLDRVMLAFQAAVSHT
GTR