Protein Info for AZOBR_RS18550 in Azospirillum brasilense Sp245

Updated annotation (from data): ABC transporter for nitrate, ATPase component
Rationale: Specific phenotype on Sodium nitrate. (SEED_correct)
Original annotation: ABC transporter ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 554 PF00005: ABC_tran" amino acids 19 to 160 (142 residues), 102.7 bits, see alignment E=2.7e-33 amino acids 315 to 455 (141 residues), 97.9 bits, see alignment E=8e-32 TIGR01184: nitrate ABC transporter, ATP-binding proteins C and D" amino acids 315 to 543 (229 residues), 317 bits, see alignment E=1.4e-98

Best Hits

KEGG orthology group: None (inferred from 84% identity to azl:AZL_e03530)

Predicted SEED Role

"Nitrate ABC transporter, ATP-binding protein" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AST9 at UniProt or InterPro

Protein Sequence (554 amino acids)

>AZOBR_RS18550 ABC transporter for nitrate, ATPase component (Azospirillum brasilense Sp245)
MAILELKNVAKSYGGTEVLRGIDLSIAEGEFVAIVGFSGAGKTTLVNLMGGLAAPDAGTV
LFRGAPVRGPGAERGVVFQNYSLMPWLSVKDNVALAVDAVHKGKPSPERGVLTRRAVETV
GLGHATDRRPKELSGGMRQRVGFARALAMSPEMLLLDEPLSALDALTRAKLQDEIEAIWR
KDRKTVVLITNDVDEAILLADRIIPLTPGPGATLGPAFAVDLPRPRDRTAVNHDPDFKRL
RAEVTAWLMEAGASRAAAAVDESLTMPAATPITAAPPPKAYLAGQPGGLSDDRYVEFSRV
TKTFATPKGPLTVVDGFDLKMRKGEFISLIGHSGCGKSTVLSMVAGLADVSSGGIVLDGK
EVVGAGPDRAVVFQAPSLFPWLTALENVMLGVDRVYPQAGRGERNDIARYYLSRVGLGNA
MHKTAAELSNGMKQRVGIARAFALSPKLLLLDEPFGMLDSLTRWELQEVLMEVWARTQVT
AICVTHDVDEAILLADRVVMMSNGPNARIGHILEVDIPHPRTRQALLEHPRYYAYREELL
NFLEGGHHGTVKAA