Protein Info for AZOBR_RS18170 in Azospirillum brasilense Sp245

Annotation: sugar ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF01547: SBP_bac_1" amino acids 45 to 321 (277 residues), 113.3 bits, see alignment E=2.5e-36 PF13416: SBP_bac_8" amino acids 49 to 344 (296 residues), 104.3 bits, see alignment E=1.1e-33

Best Hits

KEGG orthology group: K02027, multiple sugar transport system substrate-binding protein (inferred from 60% identity to ara:Arad_8610)

Predicted SEED Role

"ABC transporter, substrate binding protein [sugar]"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8ASL0 at UniProt or InterPro

Protein Sequence (411 amino acids)

>AZOBR_RS18170 sugar ABC transporter (Azospirillum brasilense Sp245)
ITPLLAGGLAAALAMGTASVALAQSSGKTVVTFAASHFAEVGRGDRLKAWVETFNQSQPD
IEVKPVTIPFSSFATTIFTQMGGNGGPDVIRFDLPEFYAAVAAKSVLPIDDIVKDGAHNF
TAADQYMKVEGKRYGFAFDTANYAMVYNAALLPNGTPPKTFEEFVKLGKEATKDGNYGFA
FRATMAERGGVWYDLTNFVYGFGGRWSKPDGTPTFNSPEVVAGVAAYKTVYDAGMIPKGT
DAATYRRMFWEGKVAMEIDNGGVATILTSQGKAHPIAAAPSPFPHKEQGMILAPVTINAN
TKVKDAAGKFLQWALQPQQQQELQTLLGAANVATTVERTPEELQAMPWLKVYDAQTPNSV
PALPQGLETKAPEIQQIIVQQLLKVLQGGVAPQTAMDEAQRLITARVLAQK