Protein Info for AZOBR_RS18150 in Azospirillum brasilense Sp245
Annotation: membrane protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.
Best Hits
KEGG orthology group: K02027, multiple sugar transport system substrate-binding protein (inferred from 64% identity to smd:Smed_5747)Predicted SEED Role
"Maltose/maltodextrin ABC transporter, substrate binding periplasmic protein MalE" in subsystem Bacterial Chemotaxis or Maltose and Maltodextrin Utilization
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See G8ASK6 at UniProt or InterPro
Protein Sequence (383 amino acids)
>AZOBR_RS18150 membrane protein (Azospirillum brasilense Sp245) MRYRALTWDHPRGYNALAAAAAGLDEERDGLAIDWDKQPLEGFEAHPISDLCARYDLIVL DHPHVGEAVAERGLIPLEDLFTAADIAGWQRDSIGPSLASYRFADRHWALPLDAATQVMA CRADLLDEPIPVTWAEVASLSERAPVALSLAGPHACLTFLSMATAFGDPPAVADPDRLVS AEVGERVLDLMATLAGRMPAAVRGLNPIGLLGHMARIDKVALCPLVYGYVNYAAPTAAGE KPVTFADAPRATADGRPGSTLGGTGIGVSVRCEVTPALLDHLRWLLGAEAQRSFIPAHDG QPSRRDAWADTAVNERWGGFYRNTAATLEAAYVRPRHAGYIAFQADAAAMIRDALADGTP HPALLDRLQHRYAASRPVAGTER