Protein Info for AZOBR_RS17945 in Azospirillum brasilense Sp245

Annotation: multidrug ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 558 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 52 to 79 (28 residues), see Phobius details amino acids 135 to 153 (19 residues), see Phobius details amino acids 156 to 174 (19 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details amino acids 260 to 284 (25 residues), see Phobius details PF00664: ABC_membrane" amino acids 17 to 286 (270 residues), 173.1 bits, see alignment E=1e-54 PF00005: ABC_tran" amino acids 349 to 498 (150 residues), 109.1 bits, see alignment E=2.9e-35

Best Hits

Swiss-Prot: 60% identical to YWJA_BACSU: Uncharacterized ABC transporter ATP-binding protein YwjA (ywjA) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 75% identity to mci:Mesci_1104)

Predicted SEED Role

"ABC transporter, nucleotide binding/ATPase protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8ASF9 at UniProt or InterPro

Protein Sequence (558 amino acids)

>AZOBR_RS17945 multidrug ABC transporter ATP-binding protein (Azospirillum brasilense Sp245)
MLRRFLSYYRPFTGLLVLDIVCAVLSGLLELGFPMAVRAFVDQLLPTQDWPLIVAATVAL
LAIYMANGGLMAIVTYWGHMLGVNIETEMRRKSFDHLQKLSFSFYDNNKTGHLVGRVTRD
LDEIGEVAHHGPEDLLIAVMTFVGAFTLMAVVHLPLALITAAIVPVIAFVTSRYGGRMTK
NWQSLYSRVGDFNVRIEENVGGMRVVQAFTNEDHERKLFAEDNDRYRTTKLAAYKIMAAS
TTLSYMSMRLILIVVMLTGAHFVLVGELTQGGFFAFLLLVNTFFRPIEKINAVIETYPRG
IAGFRRYTQLLDTQPDIADAPGAVAAPALKGDIRYEGVSFGYDPARPVLKGIDLSIKAGS
TVAFVGPSGAGKTTICSLLPRFYEVMAGRITIDGLDIRAMTLASLRRQIGIVQQDVFLFG
GTIRENIAYGRLGAGDAEIMEAARRAHLDGLIASLPEGLDTVIGERGVKLSGGQKQRLTI
ARMFLKNPPILILDEATSALDTQTEREIQKSLMELAEGRTTLVIAHRLATIRNADEVYVV
GTEGGLQRITHEELAARG