Protein Info for AZOBR_RS17740 in Azospirillum brasilense Sp245

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 PF01161: PBP" amino acids 15 to 152 (138 residues), 139.7 bits, see alignment E=3.8e-45 TIGR00481: Raf kinase inhibitor-like protein, YbhB/YbcL family" amino acids 20 to 151 (132 residues), 114.9 bits, see alignment E=1.3e-37

Best Hits

Swiss-Prot: 43% identical to Y1250_AQUAE: UPF0098 protein aq_1250 (aq_1250) from Aquifex aeolicus (strain VF5)

KEGG orthology group: K06910, (no description) (inferred from 53% identity to mno:Mnod_3676)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AS99 at UniProt or InterPro

Protein Sequence (154 amino acids)

>AZOBR_RS17740 hypothetical protein (Azospirillum brasilense Sp245)
MPFALYSPAFPNGQTIPSRHTADGGNISPPLEWRDAPAGTRSYALIVDDPDAPRGVFHHW
AVYNVAAERDRLPEGVTAGAKTESLGHGINDYGHAHYDGPNPPRGHAAHHYRFRLMALDV
DALGLGPKATVNEVRKEAGKHLLGEAELVGTYAH