Protein Info for AZOBR_RS17635 in Azospirillum brasilense Sp245

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 545 transmembrane" amino acids 19 to 39 (21 residues), see Phobius details amino acids 299 to 322 (24 residues), see Phobius details PF02743: dCache_1" amino acids 47 to 281 (235 residues), 67.7 bits, see alignment E=1.6e-22 PF00672: HAMP" amino acids 318 to 369 (52 residues), 33.5 bits, see alignment 6.3e-12 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 382 to 537 (156 residues), 140.8 bits, see alignment E=1.7e-45 PF00990: GGDEF" amino acids 385 to 537 (153 residues), 157.2 bits, see alignment E=4.9e-50

Best Hits

KEGG orthology group: None (inferred from 44% identity to alv:Alvin_0977)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AS67 at UniProt or InterPro

Protein Sequence (545 amino acids)

>AZOBR_RS17635 hypothetical protein (Azospirillum brasilense Sp245)
MLVAVVDELRRQSRSVIVRLMLFGLALVFVGACARIWVLSSFLEGKINNLASSQQQSTAS
YVAHDIDEKIKARLDLLRRAAGSLPLAALDDPTALRDWLKRHQDIAPLFSRGLMVVRPDG
HEVVADYPERHRSPDFDVSSRDWFQAALNSREPVIGRPARSSLDDEPMVVMAMAVTDAAG
RPVAVLSGATALSSPGFLNLVQGNRIGRSGGFLLVSPRDRLFVSASDHGMILTATPPEGV
NPLHDRAMAGYRGTGVTVNAAGVEELSAIAAVPTAGWFLVARLPTAEAFEGVRDLQTFIA
TNSLMIAAFAVTVLFIGMRRFFRPLTEAARRMHQMADGHVELAPLPVHRMDEVGELAQGF
NYLLGKLREQEAALRASEARMAHMAHHDALTGLPNRAMFHDRLQQAIDRSERGGALFALL
YIDLDGFKPINDTHGHSRGDEVLRVVARRLSGLLRKSDLIARIGGDEFAIILEVEVTPAG
AETVADKCRTALAEPILIDGLRLPLALSIGVAVYPQDGRDAQQLIVHADQAMYAVKRGAV
RVPAL