Protein Info for AZOBR_RS17450 in Azospirillum brasilense Sp245

Annotation: putative SIMILAR TO BETA SUBuniT OF CITRATE LYASE protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 PF03328: HpcH_HpaI" amino acids 6 to 223 (218 residues), 126 bits, see alignment E=7.1e-41

Best Hits

KEGG orthology group: K01644, citrate lyase subunit beta / citryl-CoA lyase [EC: 4.1.3.34 4.1.3.6] (inferred from 45% identity to sno:Snov_4286)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.34, 4.1.3.6

Use Curated BLAST to search for 4.1.3.34 or 4.1.3.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AS22 at UniProt or InterPro

Protein Sequence (287 amino acids)

>AZOBR_RS17450 putative SIMILAR TO BETA SUBuniT OF CITRATE LYASE protein (Azospirillum brasilense Sp245)
MSLPYQSYLFVPADNAKLLEKAHQRGADALILDLEDAVLPAGKPEARRGLPEPIDRLHGL
GVPVLVRINSGWRDAVADLEAAVRPGVAALVVPKAEDAGALRVLSAMIAEWEAERGLTPG
AIGLVALIESPLGLERLSGIAAVPRVAALALGSEDFALTLGVEPTEALLALPCRQIALAA
AARGLAAIGLPGSLAEFRDLDAYRAMVAQARAVGMTGALCIHPAQLPVVRDVFSPSAADV
AWAGRVVAAWDEAQAAGRGAVQVDGRMVDRPVAERAKAILARRAPTA