Protein Info for AZOBR_RS17395 in Azospirillum brasilense Sp245

Annotation: lysine transporter LysE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 transmembrane" amino acids 6 to 32 (27 residues), see Phobius details amino acids 40 to 88 (49 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 149 to 173 (25 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details PF01810: LysE" amino acids 15 to 200 (186 residues), 108.8 bits, see alignment E=1.3e-35

Best Hits

KEGG orthology group: None (inferred from 69% identity to azl:AZL_d00800)

Predicted SEED Role

"cell processes; transport of small molecules; amino acids, amines, peptides"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AS10 at UniProt or InterPro

Protein Sequence (209 amino acids)

>AZOBR_RS17395 lysine transporter LysE (Azospirillum brasilense Sp245)
MPIEAWLAFTAASAVLLIIPGPTILLVVSYALGQGRRSGLATVVGVALGDFTAMTASMLG
LGVVLAASSLLFTALKWIGAAYLVYLGLKLWRAPVVEATSTEPAPAVSPFRMALHTYAVT
ALNPKSIVFFVAFLPQFVDSTQPLLPQILIMEATFLVLATLNATLYALLASAAGRAVQRP
SIRRIFNRTGGAMLIGAGVMTATWRRTAS