Protein Info for AZOBR_RS16935 in Azospirillum brasilense Sp245

Annotation: argininosuccinate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00838: argininosuccinate lyase
  • amino acids 26 to 478 (453 residues), 608.4 bits, E=4.8e-187
• PF00206: Lyase_1
  • amino acids 33 to 323 (291 residues), 273.7 bits, E=2.3e-85
• PF14698: ASL_C2
  • amino acids 386 to 454 (69 residues), 93.7 bits, E=7.9e-31

Best Hits

Swiss-Prot: 69% identical to ARLY_MAGSA: Argininosuccinate lyase (argH) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K01755, argininosuccinate lyase [EC: 4.3.2.1] (inferred from 89% identity to azl:AZL_d01140)

Predicted SEED Role

"Argininosuccinate lyase (EC 4.3.2.1)" in subsystem Arginine Biosynthesis extended (EC 4.3.2.1)

MetaCyc Pathways

• superpathway of arginine and polyamine biosynthesis (17/17 steps found)
• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• superpathway of L-citrulline metabolism (10/12 steps found)
• urea cycle (4/5 steps found)
• nitric oxide biosynthesis II (mammals) (2/3 steps found)
• canavanine biosynthesis (2/4 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.2.1

Sequence Analysis Tools

See G8ARQ9 at UniProt or InterPro

Protein Sequence (480 amino acids)

>AZOBR_RS16935 argininosuccinate lyase (Azospirillum brasilense Sp245)
MSAEQPKPNSQDRAAQNVSAPAASQMWGGRFARGPAAIMERINASIGFDKRLADQDIAGS
KAHAAMLARQGIITQADADAIREGLDRVKEEIDSGAFTFKVELEDIHMNVEARLAELIGE
PAKRLHTGRSRNDQVATDFKLWVRDALDRADQGLKALQAALIDLAEKHTDTVMPGFTHLQ
AAQPVSFGHHLLAYVEMFGRDRGRLRDARARLNECPLGSAALAGTPYPIDRFMTAEALGF
DRPTANSLDAVSDRDFALEYLAAASICGMHLSRFAEEIVLWCSAQFRFIKLTDAFTTGSS
IMPQKKNPDAAELVRAKAGRVIGSLNSLLVAMKGLPLAYSKDMQEDKEPVFEADDTLALC
IAAMEGMVRDMQPNVPALREATDRGFLNATDLADWLVRELNIPFREAHHITGRAVKAAED
KRVGLTALTLEELQAIEPRITESVFPALSIEASLDSRRSFGGASPVRVREAVAAARERFL