Protein Info for AZOBR_RS16840 in Azospirillum brasilense Sp245

Annotation: branched-chain amino acid ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 46 to 65 (20 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 138 to 161 (24 residues), see Phobius details amino acids 173 to 199 (27 residues), see Phobius details amino acids 211 to 229 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 12 to 225 (214 residues), 91.3 bits, see alignment E=3e-30

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 88% identity to azl:AZL_a05310)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8ARN6 at UniProt or InterPro

Protein Sequence (237 amino acids)

>AZOBR_RS16840 branched-chain amino acid ABC transporter (Azospirillum brasilense Sp245)
VLLAGVLGLDPILAAPVVAAVLFAFGWVLQRGLVNRFVERPEHMQFILLLGIATIILNAM
LMLFGPDSRNVMVPYSFDTVEIGPLLLDAVRLRAGAGAIVVTVALFAFFRFSRTGKAIRA
CADNPLGARVVGLNIDGLYALTFGIGAGVVGIAGALMTLLVDSRPQLAPEYTLLSFIIVI
VGGLGSLPGALLGGMLIGFSEAMAGFLLDPSLKSLFSYGVLIVVLLLRPQGLLGKRS