Protein Info for AZOBR_RS16495 in Azospirillum brasilense Sp245

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 PF17396: DUF1611_N" amino acids 39 to 124 (86 residues), 88.3 bits, see alignment E=3.4e-29 PF07755: DUF1611" amino acids 129 to 326 (198 residues), 235.3 bits, see alignment E=4e-74

Best Hits

KEGG orthology group: None (inferred from 81% identity to mno:Mnod_4476)

Predicted SEED Role

"Protein often near L-alanine-DL-glutamate epimerase (cell wall recycling)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8ARG0 at UniProt or InterPro

Protein Sequence (337 amino acids)

>AZOBR_RS16495 hypothetical protein (Azospirillum brasilense Sp245)
MNIPHPYLMFLGDVQDQLGAKTAQGIVDWRRDWCLGQIRLEGCKADLGIPDMTIAEAAGQ
GARTLVVGVVNAGGVLPEHWTSVIVQAIEAGMDVASGLHTRLESIPAIAEAAARHGRQLF
NVRHSDQRFATGKGTKRSGRRLLTVGTDCSVGKKYTALALEKEMRARGMDADFRATGQTG
VFISGRGVAIDAVVADFISGAVEWIAPAADPAHWDLIEGQGSLYHPSFAGVSLGLLHGAQ
PDAFVVCHEPTRSTMRGVQHPLPSIQEVIDLTIRCGQLTNPAIRPVGIAINTKAYGEDEA
RACLEAAAKAHGLPASDPIRFGVGEIIDRLTEEFATE