Protein Info for AZOBR_RS16420 in Azospirillum brasilense Sp245

Annotation: excinuclease ABC subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 712 TIGR00631: excinuclease ABC subunit B" amino acids 22 to 674 (653 residues), 1034.2 bits, see alignment E=0 PF04851: ResIII" amino acids 30 to 156 (127 residues), 45.6 bits, see alignment E=2.2e-15 PF00270: DEAD" amino acids 35 to 103 (69 residues), 26.7 bits, see alignment E=1.3e-09 PF17757: UvrB_inter" amino acids 177 to 267 (91 residues), 109.8 bits, see alignment E=1.7e-35 PF00271: Helicase_C" amino acids 457 to 563 (107 residues), 72.8 bits, see alignment E=8.4e-24 PF12344: UvrB" amino acids 570 to 611 (42 residues), 80.5 bits, see alignment 1.9e-26 PF02151: UVR" amino acids 643 to 676 (34 residues), 30.8 bits, see alignment (E = 5.5e-11)

Best Hits

Swiss-Prot: 72% identical to UVRB_ZYMMO: UvrABC system protein B (uvrB) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K03702, excinuclease ABC subunit B (inferred from 91% identity to azl:AZL_015800)

MetaCyc: 66% identical to UvrABC excision nuclease subunit B (Escherichia coli K-12 substr. MG1655)
3.1.25.-

Predicted SEED Role

"Excinuclease ABC subunit B" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8ARE2 at UniProt or InterPro

Protein Sequence (712 amino acids)

>AZOBR_RS16420 excinuclease ABC subunit B (Azospirillum brasilense Sp245)
MSHPVLTALPQKSLPKLEAGKKFELVSEFKPSGDQPRAIGELTEGLRAGEKDQVLLGVTG
SGKTFTMAHVIQHVQRPTLVLAPNKTLAAQLYGEMKSFFPNNAVEYFVSYYDYYQPEAYV
PRTDTFIEKESSINEQIDRMRHSATRALLERDDVIIVASVSCIYGIGSVETYSEMTVDLR
RGQVVAQPDLLRKLTELQYKRNDAAFGRGLFRVRGDTVELFPAHMEDRAWRISLFGDEIE
GIHEIDPLTGEKIASLEAVRIYPNSHYVTPKPTLNQAIEQIKRELKLRLEEFNAQGKLLE
AQRLEQRTTFDIEMMAATGACAGIENYSRYLTGRAAGEPPPTLFEYLPGDALLIVDESHV
MVPQIGGMYRGDRMRKETLSEYGFRLPSAMDNRPLKFEEWEGMRPQTVFVSATPGPWEME
RTGGVFAEQVVRPTGLIDPEVIIRPTETQVDDLIHECKEVVAKGNRVLVTTLTKKMAEAL
TEYMHEAGLRVRYIHSDVETLERIEIIRDLRLGAYDVLVGINLLREGLDIPECSLVAILD
ADKEGYLRSKTSLIQTIGRAARNVEGRAILYADKITGSMQYAIDETARRREKQRAYNLEH
GITPESVKKAIGDILESVYERGDHVTVKTGLNASELVGHNLKSVMADMEKRMKAAAADLE
FEEAARLRDELRRLEAMDLGLEQPGSIGISSARQGRGIPEGAPKKQGRRGRR