Protein Info for AZOBR_RS16110 in Azospirillum brasilense Sp245

Annotation: inosine-5`-monophosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00478: IMPDH
  • amino acids 10 to 478 (469 residues), 552.1 bits, E=9.2e-170
• TIGR01302: inosine-5'-monophosphate dehydrogenase
  • amino acids 10 to 459 (450 residues), 659.2 bits, E=1.6e-202
• PF00571: CBS
  • amino acids 95 to 148 (54 residues), 45.8 bits, 1.3e-15
  • amino acids 156 to 209 (54 residues), 42.5 bits, 1.4e-14
• PF03060: NMO
  • amino acids 243 to 380 (138 residues), 38.3 bits, E=2.2e-13
• PF01070: FMN_dh
  • amino acids 264 to 369 (106 residues), 26.3 bits, E=7.4e-10

Best Hits

Swiss-Prot: 68% identical to IMDH_RHITR: Inosine-5'-monophosphate dehydrogenase (guaB) from Rhizobium tropici

KEGG orthology group: K00088, IMP dehydrogenase [EC: 1.1.1.205] (inferred from 92% identity to azl:AZL_020930)

MetaCyc: 61% identical to inosine 5'-monophosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
IMP dehydrogenase. [EC: 1.1.1.205]

Predicted SEED Role

"Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205)" in subsystem Purine conversions (EC 1.1.1.205)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• superpathway of purine nucleotide salvage (13/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• inosine 5'-phosphate degradation (4/4 steps found)
• purine nucleotides degradation II (aerobic) (9/11 steps found)
• ureide biosynthesis (6/7 steps found)
• adenosine nucleotides degradation I (5/8 steps found)
• purine nucleotides degradation I (plants) (6/12 steps found)
• superpathway of purines degradation in plants (8/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.205

Use Curated BLAST to search for 1.1.1.205

Sequence Analysis Tools

See G8AR73 at UniProt or InterPro

Protein Sequence (492 amino acids)

>AZOBR_RS16110 inosine-5`-monophosphate dehydrogenase (Azospirillum brasilense Sp245)
MARSSTIREALTFDDVLLVPAESSVLPNEVDTRTRLTKTIELGIPLMSSAMDTVTESSLA
IAMAQAGGIGVVHRNLTIEQQAEEVRKVKRYESGMVVNPITITPGQTLADALQLMADYRI
SGIPVVESHDSRGSGKLVGILTNRDVRFATNPNQPVSELMTKDVVSVREGVSQDEAKRLL
HQHRIEKLLVVDEAHRCIGLVTVKDMEKAQAYPNACKDAQGRLRVAAATGTGSDGLRRAE
ALFDAGVDVLVVDTAHGHSLKVLDQVRAARNMSNYTQVIAGNVATAEAAKALVDAGADAV
KVGIGPGSICTTRIVAGVGVPQLTAIMDVVEACEKMGIPVIADGGIKFSGDLAKAIAAGA
SVAMLGSLFAGTDESPGEVILYQGRSYKSYRGMGSVGAMARGSADRYFQQEVSTMKLVPE
GVEGRVPYKGPVSAVIHQLVGGLRAAMGYTGSQSIAEMQTKCEFVRITNAGLRESHVHDI
TITNESPNYRQG