Protein Info for AZOBR_RS15915 in Azospirillum brasilense Sp245

Updated annotation (from data): gluconate TRAP transporter, periplasmic solute-binding component
Rationale: Specifically important for gluconate utilization. The small component is AZOBR_RS15925 (misannotated as a pseudogene).
Original annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR00787: TRAP transporter solute receptor, DctP family" amino acids 35 to 290 (256 residues), 276.5 bits, see alignment E=1.1e-86 PF03480: DctP" amino acids 35 to 317 (283 residues), 315.2 bits, see alignment E=2.1e-98

Best Hits

Swiss-Prot: 37% identical to YIAO_ECOLI: 2,3-diketo-L-gulonate-binding periplasmic protein YiaO (yiaO) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 81% identity to azl:AZL_d00410)

MetaCyc: 37% identical to 2,3-diketo-L-gulonate:Na+ symporter - periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-235

Predicted SEED Role

"TRAP-type transport system, periplasmic component, predicted N-acetylneuraminate-binding protein" in subsystem Sialic Acid Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AR24 at UniProt or InterPro

Protein Sequence (337 amino acids)

>AZOBR_RS15915 gluconate TRAP transporter, periplasmic solute-binding component (Azospirillum brasilense Sp245)
MKLLRSVLLATGLAAAILAPVAASAQDIKPRLIRFGYGLSESSNQGRAVKFFVEDMAKRS
GGKLKVKGFADASLGSDIQMQNALIGGAQEMMVGSTATLVGIVKDFAVFDLPFLFNNEQE
ADAVFDGPFGQKLAAKLNDKGLVGLVYWENGFRNLTNSKRPVEKVEDLKGIKLRVMQNPV
YIDMFNGFGANAVPLSFSELFTAMETGTVDGQENPVTTIQSSKFYEVQKYLTISKHVYSP
WIVLASKRWYDGLSADERKIINEAAVASRDFERKDSREASKQSIAYLKDKGMQINELSDA
ELGRMREMVKPAMDKFAADGGADLLNELQGEISKVRK