Protein Info for AZOBR_RS15765 in Azospirillum brasilense Sp245

Annotation: osmoprotectant uptake system permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 42 to 66 (25 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details amino acids 141 to 162 (22 residues), see Phobius details amino acids 182 to 205 (24 residues), see Phobius details amino acids 216 to 238 (23 residues), see Phobius details amino acids 244 to 269 (26 residues), see Phobius details amino acids 308 to 322 (15 residues), see Phobius details amino acids 325 to 349 (25 residues), see Phobius details amino acids 355 to 381 (27 residues), see Phobius details PF00528: BPD_transp_1" amino acids 200 to 376 (177 residues), 86.8 bits, see alignment E=7.8e-29

Best Hits

KEGG orthology group: K05846, osmoprotectant transport system permease protein (inferred from 73% identity to azl:AZL_a10050)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AQZ1 at UniProt or InterPro

Protein Sequence (390 amino acids)

>AZOBR_RS15765 osmoprotectant uptake system permease (Azospirillum brasilense Sp245)
MTRVRPIHNRVALLLAAMTVAAALALPFLGFAPNRLLSGKSIALSAVAGAGGSAAALLPV
ALLLAVPFLRPGRAVNALYVGAGVLTAAGLVWLAGQHAALLAATASPAARTSLGAGFWVM
EAAAFLAVLDGVRRLELGPAGRVAVGALAAALIGGQFAAGHLDQLSIMKEYANQRDVFAG
AVLRHAALVAAALVPTLLIGVPLGIAAQRSAAVGRLVFPVLNVVQTIPSIALFGLLLAPL
SALAAAFPGLGIGGVGPVPAVIALTLYSLLPIARNTAAGLAGVPEPVREAARGIGMTPRQ
IFWRVEAPLALPVFLAGLRITLVQAVGLAAVAALIGAGGLGAIMFQGLFANALDLVLLGA
VPVILLAVAADAALKLASALALAQLGRTAA