Protein Info for AZOBR_RS15720 in Azospirillum brasilense Sp245

Annotation: LacI family transcription regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00356: LacI" amino acids 1 to 45 (45 residues), 54 bits, see alignment 2.4e-18 PF00532: Peripla_BP_1" amino acids 57 to 324 (268 residues), 90.5 bits, see alignment E=2.7e-29 PF13407: Peripla_BP_4" amino acids 59 to 255 (197 residues), 36.5 bits, see alignment E=8.3e-13 PF13377: Peripla_BP_3" amino acids 172 to 335 (164 residues), 100.5 bits, see alignment E=2.2e-32

Best Hits

KEGG orthology group: K06145, LacI family transcriptional regulator, gluconate utilization system Gnt-I transcriptional repressor (inferred from 60% identity to axy:AXYL_02251)

Predicted SEED Role

"Gluconate utilization system Gnt-I transcriptional repressor" in subsystem D-gluconate and ketogluconates metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AQY2 at UniProt or InterPro

Protein Sequence (335 amino acids)

>AZOBR_RS15720 LacI family transcription regulator (Azospirillum brasilense Sp245)
MADVAAAAGVSAMTVSRALRRPDTVSEEVRARVEEASRRLGFVPSRVASALASARTMTVA
VLIPSLTNAVFIDLLAGVQETLSPQGYQPLVGITGYGPEAEERVLRTQLAHDPDGVILSG
LDHTPGTWDLLRGLTIPVVHTMDLAAEVEHSDCPVQTVGFSQFDAGYAVGAHLAARGRRR
IGLIAGQLDPRTRQRCDGWRQALRDAGRHDPALELMVPDATSVGLGAELLERTLATHPDT
DALFLCNDDLAQGALFQCARLGIPVPERLAVAGFNDLAGAAWTVPPLTTVATPRRAIGVE
AARLLIAGMADRTPKSRENPRRVDLGFRLMVRETT