Protein Info for AZOBR_RS15535 in Azospirillum brasilense Sp245

Annotation: heme biosynthesis protein HemY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 122 TIGR00049: iron-sulfur cluster assembly accessory protein" amino acids 17 to 121 (105 residues), 128.1 bits, see alignment E=7.2e-42 PF01521: Fe-S_biosyn" amino acids 17 to 118 (102 residues), 70.9 bits, see alignment E=5.3e-24

Best Hits

Swiss-Prot: 56% identical to ERPA_AZOSB: Putative iron-sulfur cluster insertion protein ErpA (erpA) from Azoarcus sp. (strain BH72)

KEGG orthology group: None (inferred from 82% identity to azl:AZL_a04450)

Predicted SEED Role

"probable iron binding protein from the HesB_IscA_SufA family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AQU1 at UniProt or InterPro

Protein Sequence (122 amino acids)

>AZOBR_RS15535 heme biosynthesis protein HemY (Azospirillum brasilense Sp245)
MPDTALPAAAQEGARVLTVSDSAAKRVAFLIEHEGDPALMLRLTVSGGGCSGFQYGFAFD
ATANEDDHVFEKNGVKVVTDDVSLDLLAGSTLDYVEDLMGAAFQIKNPNATASCGCGNSF
AA