Protein Info for AZOBR_RS15000 in Azospirillum brasilense Sp245

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 527 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 142 to 160 (19 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 194 to 227 (34 residues), see Phobius details amino acids 239 to 264 (26 residues), see Phobius details amino acids 284 to 303 (20 residues), see Phobius details amino acids 310 to 331 (22 residues), see Phobius details amino acids 337 to 354 (18 residues), see Phobius details amino acids 366 to 383 (18 residues), see Phobius details amino acids 395 to 413 (19 residues), see Phobius details amino acids 421 to 441 (21 residues), see Phobius details amino acids 447 to 466 (20 residues), see Phobius details amino acids 478 to 496 (19 residues), see Phobius details PF02366: PMT" amino acids 115 to 220 (106 residues), 23 bits, see alignment E=2.7e-09

Best Hits

KEGG orthology group: None (inferred from 62% identity to azl:AZL_d00250)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AQG1 at UniProt or InterPro

Protein Sequence (527 amino acids)

>AZOBR_RS15000 membrane protein (Azospirillum brasilense Sp245)
VPGSGVLDRWPWWGLCVALAAVMVVSALAIGFRTPYWSHADQDLVLAYHGLLFSEGLPQE
YFDHPGYTYFLVIEVWYRLLHALGLMPVITLSGLPPAADTAAYNAAWQNLVEAGRALSIL
VTTGFALIYANLVRALVGDRRVAFLAAVVMAFGIGLSTQARQMRTDLLSASFVVTALLLV
LVAIRTAPGWRPLLLLGLAGLLAGLAVVTKIQAIFLALGIPVIALAFGRRFTGDGGRHWI
AAGILALAAGAAALPAAALIQHGIASAGQSLYPYRPVGGGLSGVYQGIIVGWVFLGMAVY
AAVWRVRLSYAVAAMAAVALGLALGVLALTIRPHEQNVIAVANLIEHMFVFTTWKHQAAL
QGQEQVLSEGLVTLLAKGLWRTLAIRTIVFHPDNIPQTVVVEWFIIGGCIVLWRRGERVT
AAQAALLLLVAWGLETLFSLRGFQRAYAAYTDPLMGLAAAWVLLRLPGFLERTRTRRWMF
GMVALVVVVAQVWPAIEAIRLPNPAGQCGWIPTYMKRVEPFPFCRPG