Protein Info for AZOBR_RS13280 in Azospirillum brasilense Sp245

Annotation: glycogen debranching protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 702 TIGR02100: glycogen debranching enzyme GlgX" amino acids 17 to 691 (675 residues), 710.4 bits, see alignment E=9.6e-218 PF02922: CBM_48" amino acids 21 to 113 (93 residues), 55.6 bits, see alignment E=8.1e-19 PF00128: Alpha-amylase" amino acids 187 to 535 (349 residues), 69.8 bits, see alignment E=5e-23 PF21156: ISOA1-3_C" amino acids 597 to 670 (74 residues), 38 bits, see alignment E=2.6e-13

Best Hits

KEGG orthology group: K02438, glycogen operon protein GlgX [EC: 3.2.1.-] (inferred from 69% identity to sus:Acid_2891)

Predicted SEED Role

"Glycogen debranching enzyme (EC 3.2.1.-)" in subsystem Glycogen metabolism or Trehalose Biosynthesis (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AGT4 at UniProt or InterPro

Protein Sequence (702 amino acids)

>AZOBR_RS13280 glycogen debranching protein (Azospirillum brasilense Sp245)
MDADTGRTGTPSPPARGAAAPLGAIPTGQGTNFSVFSKHATGIELLLFDRAENAGPARVI
HLDPSTHRTYHYWHVFLPGVTAGQIYGYRAEGPWDPANGLRFDRDKLLLDPYGRAVVVPD
RYSRDDIRKPGDDCGGAMKSVVVDPGSYDWEGDAPLRRSSAQTIVYEMHVRGFTRHPSSG
VGGKTRGTFAGLIEKIPYLQKLGVTAVELLPVFQFDAQDCPPGKVNYWGYAPVSFFAPHA
AYSSRSDPLGPLDEFRDMVKALHRGGIEVILDVVFNHTAEGDHNGPTLCFRGLDNPTYYL
LEDDRSRYANYTGTGNTLNANHPVVRRMIVDSLRYWVETMHVDGFRFDLASVLSRDTSGH
PIPNAPILWDIETEPALAGTKLIAEAWDAAGLYQVGSFVGDSWKEWNGRFRDDVRAFFRG
EPGSVTQIADRILGSPEIYGHEEREAEQSVNFVTCHDGFTLNDVVSYDRKHNEANGEDNR
DGADDNRSWNCGVEGPSDDPAIERLRSRQVKNLLTVTMLSLGIPMITMGDEARRTQSGNN
NAYCQDNETSWFDWTLVETHADVHRFVTVLNTRRSLRDRMYERVPLRQLLRKAKITWHGV
TPEQPDWSRDSHSIAVEAKVEQGRLRIYLILNAYWKPLRFDLPPANDGRVGPWRRWIDTS
LDPPCDIVEWNLAPTLSELSYLVEARSVVVLIHDAGEPTQLS