Protein Info for AZOBR_RS13260 in Azospirillum brasilense Sp245

Annotation: amino acid APC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 480 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 95 to 120 (26 residues), see Phobius details amino acids 128 to 149 (22 residues), see Phobius details amino acids 158 to 180 (23 residues), see Phobius details amino acids 209 to 228 (20 residues), see Phobius details amino acids 240 to 262 (23 residues), see Phobius details amino acids 284 to 309 (26 residues), see Phobius details amino acids 338 to 357 (20 residues), see Phobius details amino acids 363 to 387 (25 residues), see Phobius details amino acids 400 to 417 (18 residues), see Phobius details amino acids 423 to 441 (19 residues), see Phobius details amino acids 453 to 473 (21 residues), see Phobius details TIGR00905: transporter, basic amino acid/polyamine antiporter (APA) family" amino acids 4 to 478 (475 residues), 600.9 bits, see alignment E=1.7e-184 TIGR03810: arginine-ornithine antiporter" amino acids 9 to 478 (470 residues), 642.1 bits, see alignment E=5.2e-197 PF13520: AA_permease_2" amino acids 10 to 418 (409 residues), 246.9 bits, see alignment E=4e-77 PF00324: AA_permease" amino acids 19 to 429 (411 residues), 70.5 bits, see alignment E=1.2e-23

Best Hits

Swiss-Prot: 53% identical to ARCD_CLOPE: Arginine/ornithine antiporter (arcD) from Clostridium perfringens (strain 13 / Type A)

KEGG orthology group: K03758, arginine:ornithine antiporter (inferred from 72% identity to sno:Snov_4206)

Predicted SEED Role

"Arginine/ornithine antiporter ArcD" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AGS8 at UniProt or InterPro

Protein Sequence (480 amino acids)

>AZOBR_RS13260 amino acid APC transporter (Azospirillum brasilense Sp245)
VAQTRKSDKLTLLPLVALVVGSMIGGGVFNLPSDMSKGASPGAILIGWMITGIGMMMLAF
VYQNLAVRKPNLNAGPYAYAKAGFGPFVGFNSAWGYWLSAFLGNVAYAVAIFSALSHFFP
IFGDGNNLPSIVGASLCLWLIHALVLSGIKQAAFVNVVTSIAKLVPLFLFVLVAIVGFHW
DRFTVDFWGTGAGSGTGGLGSVMEQVKSTMLVTLWVFIGIEGASVYSARAARRSDVGRAT
VIGFVGALGIYVLVSLLATGVLRQPELADLKVPSMAGVFESLVGPWGAALINIGLVISVG
GAFLSWTLLCAEIPYTCGRDGTFPKWFAAENANGSPVNALWATNLLIQLFLALSFFSRSA
YQFFYFIASVAILPPYVLSGAYALKLALTGEGYGAESRTKGILVGALATAYGLWLVYAAG
LQYLLMCAVLFAPGILVYVRARREHGERTFTGVEMAIAAAIAVLAVLAAWLMWTGRISPL