Protein Info for AZOBR_RS12875 in Azospirillum brasilense Sp245

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 transmembrane" amino acids 143 to 161 (19 residues), see Phobius details PF05163: DinB" amino acids 1 to 157 (157 residues), 99.1 bits, see alignment E=4.1e-32 PF12867: DinB_2" amino acids 14 to 140 (127 residues), 60.8 bits, see alignment E=3e-20

Best Hits

KEGG orthology group: None (inferred from 70% identity to azl:AZL_002760)

Predicted SEED Role

"DinB superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AGI6 at UniProt or InterPro

Protein Sequence (163 amino acids)

>AZOBR_RS12875 diguanylate cyclase (Azospirillum brasilense Sp245)
MKAHFERFARYNRWANRRLYAVAAELSDAQYREDRSAFFRSVRGTLNHILVADRVWLRRI
EGDGPTPFALDEILYDGFDDLRAAREAEDERLIRVVAEQEEARFAADLHYRSLARQAFTM
PFSAVLAHVFNHQTHHRGQAHTLLTQFGLAAPSIDFAYFLLDK