Protein Info for AZOBR_RS12345 in Azospirillum brasilense Sp245

Annotation: D-alanine--D-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01820: Dala_Dala_lig_N
  • amino acids 8 to 49 (42 residues), 36.6 bits, 8.9e-13
  • amino acids 62 to 91 (30 residues), 40.4 bits, see alignment (E = 5.9e-14)
• TIGR01205: D-alanine--D-alanine ligase
  • amino acids 8 to 311 (304 residues), 259.8 bits, E=1.5e-81
• PF02655: ATP-grasp_3
  • amino acids 103 to 279 (177 residues), 30 bits, E=7.9e-11
• PF07478: Dala_Dala_lig_C
  • amino acids 139 to 309 (171 residues), 133.6 bits, E=1e-42

Best Hits

Swiss-Prot: 56% identical to DDL_ACICJ: D-alanine--D-alanine ligase (ddl) from Acidiphilium cryptum (strain JF-5)

KEGG orthology group: K01921, D-alanine-D-alanine ligase [EC: 6.3.2.4] (inferred from 84% identity to azl:AZL_020850)

Predicted SEED Role

"D-alanine--D-alanine ligase (EC 6.3.2.4)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.4)

MetaCyc Pathways

• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (10/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (10/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (11/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (11/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (10/17 steps found)

KEGG Metabolic Maps

• D-Alanine metabolism
• Peptidoglycan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 6.3.2.4

Use Curated BLAST to search for 6.3.2.4

Sequence Analysis Tools

See G8AFN0 at UniProt or InterPro

Protein Sequence (316 amino acids)

>AZOBR_RS12345 D-alanine--D-alanine ligase (Azospirillum brasilense Sp245)
MTTPHKKHVAVLMGGWSAEREVSLVSGAGVAKALEEEGYRVTAVDVQRDLEGLLRALTDP
RPDAVFNALHGRGGEDGTIQGVLEFLGIPYTHSGVRAAAVAMDKAMTKALLAPVGVRSPK
GLVLTKGELTGGAHPMPAPYIVKPVDEGSTVGVTLVREGQNSPVGDAWTFGERALVEEFI
PGRELTVGVMGGLDGECRPLTVTEIHFEAQVYDYTAKYSAGHAVHTVPAQIPEQVAEEAK
RLAVLAHRTLGCRGVSRSDFRWDDRKSGTDGLFFLEINNQPGMTPLSLVPEQAAAVGLSY
GALVAWMVENAACQLD