Protein Info for AZOBR_RS12065 in Azospirillum brasilense Sp245

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF05951: Peptidase_M15_2" amino acids 29 to 176 (148 residues), 195.8 bits, see alignment E=3.6e-62 PF08291: Peptidase_M15_3" amino acids 79 to 169 (91 residues), 47.5 bits, see alignment E=1.9e-16

Best Hits

Swiss-Prot: 44% identical to YCBK_ECOL6: Uncharacterized protein YcbK (ycbK) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 74% identity to azl:AZL_010690)

MetaCyc: 44% identical to peptidoglycan L,D-endopeptidase (Escherichia coli K-12 substr. MG1655)
3.4.-.-

Predicted SEED Role

"FIG001587: exported protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AEZ8 at UniProt or InterPro

Protein Sequence (176 amino acids)

>AZOBR_RS12065 hypothetical protein (Azospirillum brasilense Sp245)
LTFAAATLTALAVPVLVPAVPALAAPLAGGVRRLALHNINTNEQFSGVYWADGAYRPDAL
KRLDVLLRDHRAKQVGRYDPRLFDVLARLRQTLDSDEPFRVICGYRSRRTNAMARRRSRG
VAKESYHTRGMAIDVMLPDVELKAIATAARGMEAGGVGYYPRSGFVHIDTGPVRTW