Protein Info for AZOBR_RS12005 in Azospirillum brasilense Sp245

Annotation: leucyl/phenylalanyl-tRNA--protein transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details PF03588: Leu_Phe_trans" amino acids 8 to 178 (171 residues), 237.2 bits, see alignment E=3.8e-75 TIGR00667: leucyl/phenylalanyl-tRNA--protein transferase" amino acids 10 to 192 (183 residues), 203.7 bits, see alignment E=9.5e-65

Best Hits

Swiss-Prot: 68% identical to LFTR_MAGSA: Leucyl/phenylalanyl-tRNA--protein transferase (aat) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K00684, leucyl/phenylalanyl-tRNA--protein transferase [EC: 2.3.2.6] (inferred from 76% identity to azl:AZL_023770)

Predicted SEED Role

"Leucyl/phenylalanyl-tRNA--protein transferase (EC 2.3.2.6)" in subsystem Protein degradation (EC 2.3.2.6)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AEY5 at UniProt or InterPro

Protein Sequence (213 amino acids)

>AZOBR_RS12005 leucyl/phenylalanyl-tRNA--protein transferase (Azospirillum brasilense Sp245)
MIELSASLLLRAYAAGIFPMAENADSEELYWFDPERRGVLPLEGFHVPRKLRKTVRRGPF
ALRFDTAFRAVIEACAEPTPDRPKTWINGDILRLYTELHERGCAHSVECWSGGQLVGGLY
GVALGGAFFGESMFSRVTDASKVALVHLVARLRAAGYTLLDAQFVTEHLSQFGAMEIPRA
EYRRRLAAALAVPTDFGGVDQEAAITALFGPEG