Protein Info for AZOBR_RS11930 in Azospirillum brasilense Sp245

Annotation: modulator protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 PF01523: PmbA_TldD_1st" amino acids 30 to 94 (65 residues), 40.7 bits, see alignment E=3.2e-14 PF19290: PmbA_TldD_2nd" amino acids 122 to 227 (106 residues), 59.2 bits, see alignment E=7.8e-20 PF19289: PmbA_TldD_3rd" amino acids 235 to 450 (216 residues), 262 bits, see alignment E=5e-82

Best Hits

KEGG orthology group: K03592, PmbA protein (inferred from 86% identity to azl:AZL_022890)

Predicted SEED Role

"TldE protein, part of TldE/TldD proteolytic complex"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AEW9 at UniProt or InterPro

Protein Sequence (451 amino acids)

>AZOBR_RS11930 modulator protein (Azospirillum brasilense Sp245)
MPVSTTSQPDVLNLLDDLIRKAKGAGADSADAVLFDSASLSLSQRFGKTEKLERSESGDL
GLRVFIGKRQAIVSSTDRSAKALDELVERAVAMARVVPEDPFCGLADPEQIYTTLPDLDV
CDPSEPSAELLIERARIAEEAALAVEGVTNSEGADAGWSRSTIAIAASNGFTGRYGVSRQ
SLSASVLAGTGTGMERDYDYDSKVYGSDLRDPASIGREAGERAIRRLNPRRVKSCKVPVV
FDPRVSRGLLGHLTGSISGPSIARGTSFLKDKMGQRIFAAGITIVDDPHVKRGLRSRPFD
AEGVATTRRNLIEDGHLTTWLLDLRSARQLGLSTTGHAARGTSGPPGPAPANVYMAPGAK
SRDELLAEIPNGFYVTELMGTGVNGVTGDYSRGAAGYWIENGQIAYPVTELTIAGNLKEM
FLNLEPASDLELRFGMDAPTIRIDGLTIAGL