Protein Info for AZOBR_RS11710 in Azospirillum brasilense Sp245

Annotation: urea ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 TIGR03411: urea ABC transporter, ATP-binding protein UrtD" amino acids 7 to 248 (242 residues), 378.8 bits, see alignment E=6e-118 PF00005: ABC_tran" amino acids 23 to 178 (156 residues), 103 bits, see alignment E=3.3e-33 PF12399: BCA_ABC_TP_C" amino acids 226 to 247 (22 residues), 25.7 bits, see alignment (E = 1.1e-09)

Best Hits

Swiss-Prot: 34% identical to LIVG_SALTY: High-affinity branched-chain amino acid transport ATP-binding protein LivG (livG) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01995, branched-chain amino acid transport system ATP-binding protein (inferred from 87% identity to azl:AZL_a00250)

Predicted SEED Role

"Urea ABC transporter, ATPase protein UrtD" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AES1 at UniProt or InterPro

Protein Sequence (248 amino acids)

>AZOBR_RS11710 urea ABC transporter ATP-binding protein (Azospirillum brasilense Sp245)
MSTEDTLLYLDGVSVSFDGFRALNSLSLVIEPGEMRAIIGPNGAGKTTMMDVITGKTRPD
TGTILFEGRTDLTSLREPAIANLGIGRKFQRPTVFEMHTVWDNLELSLKAPRRPLKTLTY
SATKEDRARIEEILDITRLSPRRDRPAGSLSHGEKQWLEIGMLLAQDPKLLLVDEPVAGM
TDAETEQTAHLLKDIAGKHSVIVVEHDMVFVRELGVKVTVLHEGSVLAEGSLDTVSANKQ
VIDVYLGR