Protein Info for AZOBR_RS11690 in Azospirillum brasilense Sp245

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 801 transmembrane" amino acids 270 to 293 (24 residues), see Phobius details PF13401: AAA_22" amino acids 46 to 173 (128 residues), 33.2 bits, see alignment E=1.8e-11 PF12796: Ank_2" amino acids 629 to 710 (82 residues), 44 bits, see alignment E=8e-15 amino acids 699 to 774 (76 residues), 59.2 bits, see alignment E=1.5e-19 PF00023: Ank" amino acids 679 to 711 (33 residues), 15 bits, see alignment (E = 7.6e-06) amino acids 712 to 741 (30 residues), 23.9 bits, see alignment (E = 1.2e-08) amino acids 745 to 775 (31 residues), 28.1 bits, see alignment (E = 5.2e-10) PF13637: Ank_4" amino acids 682 to 733 (52 residues), 34.1 bits, see alignment 7.9e-12 amino acids 747 to 798 (52 residues), 32.4 bits, see alignment 2.8e-11 PF13606: Ank_3" amino acids 745 to 772 (28 residues), 19.7 bits, see alignment (E = 2.7e-07)

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AER7 at UniProt or InterPro

Protein Sequence (801 amino acids)

>AZOBR_RS11690 hypothetical protein (Azospirillum brasilense Sp245)
MDRSAPKATPSSNRSAAKAKPQPQAAGLRPDQTEVFDGLLLALLARKRLLVLVGEAGSGR
AAVFHQLVEQVGSDGALVLPVAASAGAQVEDLVSAAGDAALPSDNDDRDFDTLIEELEER
LDLAGTGLLAVENAGVLAAPVLADLIDLTRSETPSGRFLQVLLCGTPEMERTLARPGLAE
AVRELGVIYRMTPGAGPSVAPTAAIPSAGLSTGPAAAPPRAAPPPPRRAAERDANDWPAN
DWDAPDGWTIPETGGPAADLPVKRPRRRAALAGAAITTLILLGAAGAGVTLAVPDATPER
ALDYARQGWQDLRTFVTERVHNPFADEPSLGSRGPDTLALARPQNPYLASLPAEAGVPVA
GPSPTAPTRTDAPPPAARTVAAPPATTPTPTPAPTPVVAARPEQTPAAPAAQAPKPPAAD
PLAAEHTQPPKPRATEYRTEQSEGPTGSATLPPLVDEPAPQMAAPAMPQPAAPTASTPFS
ASDNGLNPRVRTLVDQARRQIAAKLLTTPPNNNAYETVSRLREIAPATPEIQELLTTMEE
TYRRWASLAERDGNWDEARRFYERALIVAPNTGDLRDRIKAAGEGRVLPATPTASAAPGT
PPAPPATAEVRPGLDSRDGAIALMRRTDELKRALDGGADPNKRVDNGKTLLMLASEQGLT
DAVRMLIDRRAKTELRTADGATAVMYAAWGGHEAVIHALAAAGAELDATNDDGKTALMAA
AARGHEGVVKILVDRGVSVDRVASHGWSALMYAANNGHDRVARMLVERGANPFRMDTAGN
SALTLGALQGHMQVVEALKPH