Protein Info for AZOBR_RS11515 in Azospirillum brasilense Sp245

Annotation: 50S ribosomal protein L7/L12

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00855: ribosomal protein bL12
  • amino acids 1 to 124 (124 residues), 162.2 bits, E=3.6e-52
• PF16320: Ribosomal_L12_N
  • amino acids 5 to 50 (46 residues), 68.5 bits, E=3.2e-23
• PF00542: Ribosomal_L12
  • amino acids 58 to 124 (67 residues), 111.4 bits, E=2.1e-36

Best Hits

Swiss-Prot: 86% identical to RL7_RHOCS: 50S ribosomal protein L7/L12 (rplL) from Rhodospirillum centenum (strain ATCC 51521 / SW)

KEGG orthology group: K02935, large subunit ribosomal protein L7/L12 (inferred from 93% identity to azl:AZL_005710)

MetaCyc: 54% identical to 50S ribosomal subunit protein L12 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L7/L12 (P1/P2)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

See G8AEM6 at UniProt or InterPro

Protein Sequence (124 amino acids)

>AZOBR_RS11515 50S ribosomal protein L7/L12 (Azospirillum brasilense Sp245)
MADLQKLVDDLSALTVIEAAELSKLLEEKWGVSAAAPVAVAAAGPAAAAAPVEEQTEFNV
ILADAGDKKINVIKEVRAITGLGLKEAKDLVEGAPKPVKEGVSKDEAAKIKKQLEEAGAK
VDIK