Protein Info for AZOBR_RS10695 in Azospirillum brasilense Sp245

Annotation: potassium transporter TrkH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 44 to 67 (24 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 152 to 174 (23 residues), see Phobius details amino acids 208 to 228 (21 residues), see Phobius details amino acids 248 to 269 (22 residues), see Phobius details amino acids 298 to 317 (20 residues), see Phobius details amino acids 326 to 344 (19 residues), see Phobius details amino acids 364 to 387 (24 residues), see Phobius details amino acids 392 to 410 (19 residues), see Phobius details amino acids 429 to 453 (25 residues), see Phobius details PF02386: TrkH" amino acids 15 to 450 (436 residues), 192.4 bits, see alignment E=6.1e-61

Best Hits

Swiss-Prot: 46% identical to TRKI_HALED: Trk system potassium uptake protein TrkI (trkI) from Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9)

KEGG orthology group: K03498, trk system potassium uptake protein TrkH (inferred from 48% identity to rce:RC1_2185)

Predicted SEED Role

"Potassium uptake protein TrkH" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AN53 at UniProt or InterPro

Protein Sequence (456 amino acids)

>AZOBR_RS10695 potassium transporter TrkH (Azospirillum brasilense Sp245)
MPAVGNSDWTAFVGSSAATLAVSGGMVLATSSKEHARFTVKQHFLLTTLSWCVLATFGAL
PFMISAAHLSFTDAYYEAMSGLSTTGGTVIVGLDDAPPGVLLWRSLLNWFGGVGIIVMAI
AVLPILRVGGMQLFRTESSDKGDKPFATVQDTAGAIAMIYLALTILSAVAYHLAGMTWFD
AINHAMASIATGGFSTKDASLGWFDSHAVLWVATFSMISGALPLTWYIRLLRGQRNAPVF
GDSQVNALLAILLVAGVAMTLWAFAVVGLPFRDALSHSAVNVTSIITGTGFVSTDYSTWG
SFAVVAFFFFYFIGGCTGSTAGSIKVFRWQVLALSMLNQMQRMLKPNRVLVPLYQGKVLD
EDVVGSVINLAFAFMAAFGILSLLVAAMGVDYLSAASAVASALANAGPGLGPVVGPSGTM
APLPDAAKWVLSFAMLLGRLEVFTVLVLILPSFWRD