Protein Info for AZOBR_RS10420 in Azospirillum brasilense Sp245

Annotation: lysyl-tRNA synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 PF00152: tRNA-synt_2" amino acids 19 to 346 (328 residues), 158.1 bits, see alignment E=1.6e-50 TIGR00462: EF-P lysine aminoacylase GenX" amino acids 22 to 344 (323 residues), 385.3 bits, see alignment E=1.2e-119

Best Hits

KEGG orthology group: K04568, lysyl-tRNA synthetase, class II [EC: 6.1.1.6] (inferred from 83% identity to azl:AZL_009610)

Predicted SEED Role

"Translation elongation factor P Lys34:lysine transferase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.6

Use Curated BLAST to search for 6.1.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AMZ1 at UniProt or InterPro

Protein Sequence (350 amino acids)

>AZOBR_RS10420 lysyl-tRNA synthetase (Azospirillum brasilense Sp245)
MSPVTPAWAPETFARRRPHLAVRGRVLGAVRRFFEENAFLEVDTPALQVSPGMEPHLQAF
ATELVGPHPDDRLRLHLHTSPEFAMKKLLVAGLPRIYQIAHVFRNGERSATHAPEFSMLE
WYRAGEGYRTLIRDCEDLVREAAVAAGRTRFDFRGMTCDPFKEWRVLTVQDAFREYAGID
LLETFDGSHDPDPAPLAAMARAIGIAPHDGDRWEDIVFRIMFDRIEPHLGAGVPCVLTDY
PVCMAALSRPKPEDPRLAERFELYACGLELANAFGELTDARAQRARFEADMDLKERIYGD
RFPVDEDFLAALEHGMPECSGIALGFDRLVMLCSGAERIDEVLWLPVAGA