Protein Info for AZOBR_RS10045 in Azospirillum brasilense Sp245

Annotation: transcription antitermination protein NusB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 TIGR01951: transcription antitermination factor NusB" amino acids 29 to 171 (143 residues), 110.1 bits, see alignment E=4.6e-36 PF01029: NusB" amino acids 31 to 170 (140 residues), 91.3 bits, see alignment E=3.4e-30

Best Hits

Swiss-Prot: 46% identical to NUSB_NITHX: Transcription antitermination protein NusB (nusB) from Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)

KEGG orthology group: K03625, N utilization substance protein B (inferred from 69% identity to azl:AZL_010140)

Predicted SEED Role

"Transcription termination protein NusB" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AMQ3 at UniProt or InterPro

Protein Sequence (190 amino acids)

>AZOBR_RS10045 transcription antitermination protein NusB (Azospirillum brasilense Sp245)
MSNDDAAGRAKQKRGSRNRTGGGSAKARRKAARLAAVQALYQIDLNQIEPTGIAVESVIG
EFVNHRLGEEIDGAKFVAADPQLFADIVRGVAHRRAEVDGMLASALEPRYALDRLELLMR
AILRAGAYELFVHNDTHPRILISEYVDVAHAFFAGREPGMVNGVLDHVARALRPDELAQP
DPSRDQSKDR