Protein Info for AZOBR_RS10015 in Azospirillum brasilense Sp245

Annotation: serine hydroxymethyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 PF00464: SHMT" amino acids 9 to 386 (378 residues), 571.3 bits, see alignment E=8.7e-176 PF01041: DegT_DnrJ_EryC1" amino acids 143 to 261 (119 residues), 22.4 bits, see alignment E=6.7e-09

Best Hits

Swiss-Prot: 79% identical to GLYA_RHOCS: Serine hydroxymethyltransferase (glyA) from Rhodospirillum centenum (strain ATCC 51521 / SW)

KEGG orthology group: K00600, glycine hydroxymethyltransferase [EC: 2.1.2.1] (inferred from 93% identity to azl:AZL_010090)

MetaCyc: 71% identical to serine hydroxymethyltransferase subunit (Hyphomicrobium methylovorum GM2)
Glycine hydroxymethyltransferase. [EC: 2.1.2.1]

Predicted SEED Role

"Serine hydroxymethyltransferase (EC 2.1.2.1)" in subsystem Folate Biosynthesis or Glycine Biosynthesis or Glycine and Serine Utilization or LMPTP YwlE cluster or Photorespiration (oxidative C2 cycle) or Serine-glyoxylate cycle or Serine Biosynthesis (EC 2.1.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AMP7 at UniProt or InterPro

Protein Sequence (425 amino acids)

>AZOBR_RS10015 serine hydroxymethyltransferase (Azospirillum brasilense Sp245)
IGRFFAASLAETDPELARAVRDELVRQQEQIELIASENIVSQAVLEAQGSVMTNKYAEGY
PGRRYYGGCEYVDVAETLAIERACKLFGCGFANVQPNSGSQANQAVNLALLQPGDTILGM
SLAAGGHLTHGAAPNLSGKWFKAVQYGVRRDDHLIDFDEVERLAREHKPKLIIAGGSAYP
RVLDYQRFRAIADEVGAYFMVDIAHYAGLIAGGVYPNPFPYADVVTTTTHKTLRGPRGGM
VLTNSEEIAKKINSAVFPGLQGGPLMHVIAAKAVAFAEALRPEFKTYAKSVLDNARALSK
VLIEGGLDIVSGGTDSHIVLVDLRPKNLTGKAAEASLEHAGMTCNKNGVPFDPQKPMVTS
GVRLGSPAATTRGFGVAEFEQVGRLIVETLDGLAASNSGDNAAVEAKVREEVRELCRRFP
IYPTL