Protein Info for AZOBR_RS10010 in Azospirillum brasilense Sp245

Annotation: ribose 5-phosphate isomerase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 PF02502: LacAB_rpiB" amino acids 4 to 142 (139 residues), 198.4 bits, see alignment E=2.4e-63 TIGR01120: ribose 5-phosphate isomerase B" amino acids 4 to 142 (139 residues), 160.7 bits, see alignment E=2.1e-51 TIGR00689: sugar-phosphate isomerase, RpiB/LacA/LacB family" amino acids 4 to 142 (139 residues), 178.4 bits, see alignment E=7.5e-57

Best Hits

Swiss-Prot: 48% identical to Y402_RICCN: Putative sugar phosphate isomerase RC0402 (RC0402) from Rickettsia conorii (strain ATCC VR-613 / Malish 7)

KEGG orthology group: K01808, ribose 5-phosphate isomerase B [EC: 5.3.1.6] (inferred from 81% identity to azl:AZL_010080)

MetaCyc: 37% identical to galactose-6-phosphate isomerase lacB subunit (Staphylococcus aureus)
Galactose-6-phosphate isomerase. [EC: 5.3.1.26]

Predicted SEED Role

"Ribose 5-phosphate isomerase B (EC 5.3.1.6)" in subsystem Calvin-Benson cycle or D-ribose utilization or LMPTP YwlE cluster or Pentose phosphate pathway (EC 5.3.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.26 or 5.3.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AMP6 at UniProt or InterPro

Protein Sequence (143 amino acids)

>AZOBR_RS10010 ribose 5-phosphate isomerase B (Azospirillum brasilense Sp245)
MTTIAIASDHAGYEMKAQIASWLAGAGYEVLDLGCNGPESVDYPDFATALAGAINDKRAA
RGVLICGSGIGISIAANRHPGIRAALVHDVTTARLARQHNDANVVALGARIIGAEIAKDC
VDAFLTTDFEGGERHSRRIAKMG