Protein Info for AZOBR_RS10010 in Azospirillum brasilense Sp245

Annotation: ribose 5-phosphate isomerase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02502: LacAB_rpiB
  • amino acids 4 to 142 (139 residues), 198.4 bits, E=2.4e-63
• TIGR01120: ribose 5-phosphate isomerase B
  • amino acids 4 to 142 (139 residues), 160.7 bits, E=2.1e-51
• TIGR00689: sugar-phosphate isomerase, RpiB/LacA/LacB family
  • amino acids 4 to 142 (139 residues), 178.4 bits, E=7.5e-57

Best Hits

Swiss-Prot: 48% identical to Y402_RICCN: Putative sugar phosphate isomerase RC0402 (RC0402) from Rickettsia conorii (strain ATCC VR-613 / Malish 7)

KEGG orthology group: K01808, ribose 5-phosphate isomerase B [EC: 5.3.1.6] (inferred from 81% identity to azl:AZL_010080)

MetaCyc: 37% identical to galactose-6-phosphate isomerase lacB subunit (Staphylococcus aureus)
Galactose-6-phosphate isomerase. [EC: 5.3.1.26]

Predicted SEED Role

"Ribose 5-phosphate isomerase B (EC 5.3.1.6)" in subsystem Calvin-Benson cycle or D-ribose utilization or LMPTP YwlE cluster or Pentose phosphate pathway (EC 5.3.1.6)

MetaCyc Pathways

• Bifidobacterium shunt (15/15 steps found)
• Rubisco shunt (9/10 steps found)
• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• superpathway of glucose and xylose degradation (13/17 steps found)
• pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
• Calvin-Benson-Bassham cycle (10/13 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (7/9 steps found)
• pentose phosphate pathway (6/8 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (18/26 steps found)
• ethene biosynthesis V (engineered) (17/25 steps found)
• oxygenic photosynthesis (11/17 steps found)
• lactose degradation I (2/5 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Carbon fixation in photosynthetic organisms
• Galactose metabolism
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.26 or 5.3.1.6

Sequence Analysis Tools

See G8AMP6 at UniProt or InterPro

Protein Sequence (143 amino acids)

>AZOBR_RS10010 ribose 5-phosphate isomerase B (Azospirillum brasilense Sp245)
MTTIAIASDHAGYEMKAQIASWLAGAGYEVLDLGCNGPESVDYPDFATALAGAINDKRAA
RGVLICGSGIGISIAANRHPGIRAALVHDVTTARLARQHNDANVVALGARIIGAEIAKDC
VDAFLTTDFEGGERHSRRIAKMG