Protein Info for AZOBR_RS09850 in Azospirillum brasilense Sp245

Annotation: ATP-dependent DNA helicase RecG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 693 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details PF17191: RecG_wedge" amino acids 18 to 173 (156 residues), 37.6 bits, see alignment E=4.3e-13 TIGR00643: ATP-dependent DNA helicase RecG" amino acids 34 to 656 (623 residues), 693.8 bits, see alignment E=1.3e-212 PF04851: ResIII" amino acids 265 to 423 (159 residues), 30.7 bits, see alignment E=7e-11 PF00270: DEAD" amino acids 269 to 428 (160 residues), 79.5 bits, see alignment E=6.5e-26 PF00271: Helicase_C" amino acids 465 to 578 (114 residues), 61.5 bits, see alignment E=2.1e-20 PF19833: RecG_dom3_C" amino acids 607 to 669 (63 residues), 51.6 bits, see alignment E=2e-17

Best Hits

KEGG orthology group: K03655, ATP-dependent DNA helicase RecG [EC: 3.6.4.12] (inferred from 86% identity to azl:AZL_016620)

Predicted SEED Role

"ATP-dependent DNA helicase RecG (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.12

Use Curated BLAST to search for 3.6.1.- or 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AMK2 at UniProt or InterPro

Protein Sequence (693 amino acids)

>AZOBR_RS09850 ATP-dependent DNA helicase RecG (Azospirillum brasilense Sp245)
VRPVVLFPLFRPVTALPGLGPRLGKLVEKLAGPQVVDLLWHLPCGVIDRRYAPKIAEAPN
GRIATMTVRIDSHAAPHNSRHPYKVRCTDETGVLELIYFHVKGDWLERQMPVGKTVVVSG
KVEWFHDTPQITHPDAVVPLESKDEIEAVEPVYPMTAGLPAKTLRKAVRAMLNDVPELPE
WQDAAWRSRNGWPTWHESIRRAHTPEDEADLAPTNPIRRRLAYDELLSNQLALTLVRIQQ
RRLSGRVIQGDGRLRAKVAAALPFSLTNSQATSLAEIYEDMAAERRMLRLLQGDVGSGKT
VVALMAMLNAVEAGHQAALMAPTEILARQHAESLAPLCKAAGVDLALLTGRDKGKARQAV
LDRLASGELPLLVGTHALFQEDVAFKDLALAVIDEQHRFGVHQRLQLSAKGRAVDVLVMT
ATPIPRTLTLTAYGDMDVSRLTEKPAGRKPIQTVTIALDRLEEVVHGIHRKVQEGARVYW
VCPLVDESEQTDLAAATERHAFLRATFGDRVGLVHGKMRGPDKDAVMAAFQAGNLDVLVA
TTVIEVGVNVPEATVMVIEHAERFGLAQLHQLRGRVGRGEKPSSCLLMFDPQLTETARAR
LKTMRDTEDGFVIAEEDLRLRGAGEVLGTRQSGLPEFRMADLAVHGDLLAAARDDAKLIV
DRDPDLAGERGQALRTLLYLFERDAAAKTLRSG