Protein Info for AZOBR_RS09075 in Azospirillum brasilense Sp245

Annotation: periplasmic protein of the Tol-Pal system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details TIGR02800: Tol-Pal system beta propeller repeat protein TolB" amino acids 28 to 446 (419 residues), 478.7 bits, see alignment E=8e-148 PF04052: TolB_N" amino acids 34 to 141 (108 residues), 121.1 bits, see alignment E=3.5e-39 PF07676: PD40" amino acids 258 to 285 (28 residues), 19.4 bits, see alignment (E = 1.3e-07) amino acids 295 to 330 (36 residues), 46.8 bits, see alignment 3e-16 amino acids 339 to 369 (31 residues), 20.1 bits, see alignment (E = 7.2e-08) amino acids 382 to 414 (33 residues), 16.8 bits, see alignment (E = 7.8e-07)

Best Hits

Swiss-Prot: 66% identical to TOLB_MAGSA: Tol-Pal system protein TolB (tolB) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K03641, TolB protein (inferred from 87% identity to azl:AZL_009840)

Predicted SEED Role

"tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AM25 at UniProt or InterPro

Protein Sequence (450 amino acids)

>AZOBR_RS09075 periplasmic protein of the Tol-Pal system (Azospirillum brasilense Sp245)
MTKKTRLLLKAAGCAGALLLALGVAAPAPARAEVRIDITKGVVEPLPIAITSFAGAGGRE
AQVGSDISKVVAADLERSGLFRPLDPKGFLQTPDQLRSGEPRYQDWRAVGAQALVAGNTT
AMGDGRMKVDFRLWDVAAGQYMQGLSYTATADSWRRIAHIIADAIYKRLTGEEGYFDTRI
VYVAESGPANARKKQLAIMDQDGENHQFLTDGKNLVLTPRFSPATQEITYMSYFNKKPRV
YLFNIDSGRQEVLGDFVGMTFAPRFSPDGNKVVMSMAQNGNTDIYALDLRTRRQTQLTDS
PGIDTGPSYSPDGQRIVFESDRGGSQQLYIMNADGSGQKRLTFGEGRYGTPVWSPRGDLI
AFTRQRGSSFALGVIRPDGTGERILTESFHVEGPTWAPNGRVLSFFRDVPAGDGRGRSAK
LYTIDVTGANERRVITPLDGSDPAWSPLIP