Protein Info for AZOBR_RS09060 in Azospirillum brasilense Sp245

Annotation: biopolymer transporter ExbB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 transmembrane" amino acids 29 to 50 (22 residues), see Phobius details amino acids 140 to 163 (24 residues), see Phobius details amino acids 182 to 204 (23 residues), see Phobius details TIGR02796: protein TolQ" amino acids 20 to 232 (213 residues), 279.5 bits, see alignment E=9.6e-88 PF01618: MotA_ExbB" amino acids 89 to 220 (132 residues), 127.3 bits, see alignment E=1.5e-41

Best Hits

KEGG orthology group: K03562, biopolymer transport protein TolQ (inferred from 87% identity to azl:AZL_009810)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AM22 at UniProt or InterPro

Protein Sequence (240 amino acids)

>AZOBR_RS09060 biopolymer transporter ExbB (Azospirillum brasilense Sp245)
MDLNSAQVVGAAAKAHDITMWGLFWQADLIVKVVMLMLLVASVWCWAIIIEKLMRIRRLN
AQADAFEESFWSGGSLDALYDRIGQNPSDPMSATFAAGMREWRHAADRGIGSMKGSLQQR
VERVMSVTIGREMLRAERYMTFLASVGSTAPFIGLFGTVWGIMNSFTSIAASGNTSLAVV
APGIAEALFATALGLVAAIPAVISYNKFTTDLGRYADRLETFSGEFSAILSRHLEERGAA