Protein Info for AZOBR_RS09050 in Azospirillum brasilense Sp245

Annotation: Holliday junction DNA helicase RuvB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 PF05496: RuvB_N" amino acids 28 to 186 (159 residues), 263.9 bits, see alignment E=1.5e-82 TIGR00635: Holliday junction DNA helicase RuvB" amino acids 32 to 334 (303 residues), 444.8 bits, see alignment E=6.8e-138 PF06068: TIP49" amino acids 35 to 89 (55 residues), 26.2 bits, see alignment 1.6e-09 PF07728: AAA_5" amino acids 62 to 168 (107 residues), 25.3 bits, see alignment E=4.8e-09 PF00004: AAA" amino acids 63 to 185 (123 residues), 72.3 bits, see alignment E=1.9e-23 PF17864: AAA_lid_4" amino acids 189 to 262 (74 residues), 97.8 bits, see alignment E=8.9e-32 PF05491: RuvB_C" amino acids 264 to 333 (70 residues), 91.3 bits, see alignment E=1e-29

Best Hits

Swiss-Prot: 79% identical to RUVB_RHOCS: Holliday junction ATP-dependent DNA helicase RuvB (ruvB) from Rhodospirillum centenum (strain ATCC 51521 / SW)

KEGG orthology group: K03551, holliday junction DNA helicase RuvB (inferred from 90% identity to azl:AZL_009790)

MetaCyc: 60% identical to Holliday junction branch migration complex subunit RuvB (Escherichia coli K-12 substr. MG1655)
3.1.22.4-RXN [EC: 3.1.21.10]

Predicted SEED Role

"Holliday junction DNA helicase RuvB" in subsystem DNA-replication or RuvABC plus a hypothetical

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.21.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AM20 at UniProt or InterPro

Protein Sequence (363 amino acids)

>AZOBR_RS09050 Holliday junction DNA helicase RuvB (Azospirillum brasilense Sp245)
MTADQNGSDPDRLVQPGRGAGDSGEASIRPLSLAEFIGQRQARENLSIFIQAARSRGEAL
DHVLLFGPPGLGKTTLAQIVSRELGVGFRATSGPVIARAGDLAALLTNLQPHDVLFIDEI
HRLNPAVEEVLYPAMEDFQLDLIIGEGPSARSIRIDLPPFTLVGATTRSGLITRPLRERF
GIPVRLQFYEPDELELIVRRAAAVFNMLITPEGAREIANRSRGTPRVSGRLLRRVRDFAS
VAGVPEVDARIADAALTRLEVDRLGLDSMDRRYLGIIANNYNGGPVGVDTLGAALGEQRD
VLEEVVEPYLIQQGFLQRTPRGRMLTDQGFRYLGLNPPSAPTRQFDLLDRLSEANPDPED
GDV