Protein Info for AZOBR_RS08900 in Azospirillum brasilense Sp245

Annotation: GCN5 family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 PF13420: Acetyltransf_4" amino acids 3 to 157 (155 residues), 63.7 bits, see alignment E=5.4e-21 PF13302: Acetyltransf_3" amino acids 3 to 138 (136 residues), 26.5 bits, see alignment E=2.3e-09 PF00583: Acetyltransf_1" amino acids 38 to 137 (100 residues), 57.5 bits, see alignment E=4.2e-19 PF13673: Acetyltransf_10" amino acids 46 to 141 (96 residues), 30.8 bits, see alignment E=6.5e-11 PF13508: Acetyltransf_7" amino acids 53 to 139 (87 residues), 37.6 bits, see alignment E=5.9e-13

Best Hits

Swiss-Prot: 57% identical to PAT_ALCFA: Phosphinothricin N-acetyltransferase (pat) from Alcaligenes faecalis

KEGG orthology group: K03823, phosphinothricin acetyltransferase [EC: 2.3.1.183] (inferred from 59% identity to rva:Rvan_2288)

Predicted SEED Role

"GCN5-related N-acetyltransferase"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.183

Use Curated BLAST to search for 2.3.1.183

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8ALY8 at UniProt or InterPro

Protein Sequence (174 amino acids)

>AZOBR_RS08900 GCN5 family N-acetyltransferase (Azospirillum brasilense Sp245)
MNIRSSRLDDLERIQAIYAHHVLTGAASFEEVPPSLEELARRRDDVLARGMPYIVAEMGG
RVIGYAYTGPYRLRTAYRYSVEDSIYLDPDCMGRGAGRALLSTVIDRCEEAGCRQMIAVI
GDSANASSIGLHRSLGFEPAGLLKAVGFKFGRWVDSVLMQRPLGNGEASPPDGH