Protein Info for AZOBR_RS08740 in Azospirillum brasilense Sp245

Annotation: thiosulfate sulfurtransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00581: Rhodanese
  • amino acids 18 to 99 (82 residues), 57.9 bits, E=6.2e-20

Best Hits

Swiss-Prot: 43% identical to RHODA_ALLVD: Sulfurtransferase Alvin_2599 (rhd_2599) from Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)

KEGG orthology group: None (inferred from 73% identity to azl:AZL_013050)

MetaCyc: 43% identical to rhodanese 2599 (Allochromatium vinosum)
2.8.1.-

Predicted SEED Role

"Sulfur carrier protein adenylyltransferase ThiF" in subsystem Thiamin biosynthesis

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis II (10/11 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (6/7 steps found)
• superpathway of thiamine diphosphate biosynthesis I (8/10 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (4/6 steps found)
• sulfur oxidation IV (intracellular sulfur) (3/7 steps found)
• superpathway of sulfide oxidation (phototrophic sulfur bacteria) (5/12 steps found)

Sequence Analysis Tools

See G8ALV2 at UniProt or InterPro

Protein Sequence (108 amino acids)

>AZOBR_RS08740 thiosulfate sulfurtransferase (Azospirillum brasilense Sp245)
MPAPFDMDVEDLDRIRTSGGDPLVLDVREPGEVAICALPDSLHIPMGALPARVGELPRDR
DIVVVCHHGGRSAQVTMWLRSQGFSRATNLNGGVDAWARRIDPNMKVY