Protein Info for AZOBR_RS08740 in Azospirillum brasilense Sp245
Annotation: thiosulfate sulfurtransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 43% identical to RHODA_ALLVD: Sulfurtransferase Alvin_2599 (rhd_2599) from Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)
KEGG orthology group: None (inferred from 73% identity to azl:AZL_013050)MetaCyc: 43% identical to rhodanese 2599 (Allochromatium vinosum)
2.8.1.-
Predicted SEED Role
"Sulfur carrier protein adenylyltransferase ThiF" in subsystem Thiamin biosynthesis
MetaCyc Pathways
- superpathway of thiamine diphosphate biosynthesis II (10/11 steps found)
- thiazole component of thiamine diphosphate biosynthesis II (6/7 steps found)
- superpathway of thiamine diphosphate biosynthesis I (8/10 steps found)
- thiazole component of thiamine diphosphate biosynthesis I (4/6 steps found)
- sulfur oxidation IV (intracellular sulfur) (3/7 steps found)
- superpathway of sulfide oxidation (phototrophic sulfur bacteria) (5/12 steps found)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See G8ALV2 at UniProt or InterPro
Protein Sequence (108 amino acids)
>AZOBR_RS08740 thiosulfate sulfurtransferase (Azospirillum brasilense Sp245) MPAPFDMDVEDLDRIRTSGGDPLVLDVREPGEVAICALPDSLHIPMGALPARVGELPRDR DIVVVCHHGGRSAQVTMWLRSQGFSRATNLNGGVDAWARRIDPNMKVY