Protein Info for AZOBR_RS08500 in Azospirillum brasilense Sp245

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 23 to 43 (21 residues), see Phobius details amino acids 50 to 78 (29 residues), see Phobius details amino acids 98 to 118 (21 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details amino acids 222 to 246 (25 residues), see Phobius details amino acids 258 to 282 (25 residues), see Phobius details amino acids 293 to 311 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 49 to 305 (257 residues), 115.8 bits, see alignment E=1.1e-37

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 82% identity to azl:AZL_014100)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8ALP8 at UniProt or InterPro

Protein Sequence (327 amino acids)

>AZOBR_RS08500 ABC transporter permease (Azospirillum brasilense Sp245)
MATEIHAVRRETAAPATGRPAMPGLLALAVLLLVLIAAPYVLYPVFVMKVLCFALFACAF
NLLIGFAGLLSFGHAAFFGGAAYITAHTVKVWGLPPELGILLGTAFAATLGLAFGALAIR
RQGIYFAMITLALSQMVFFMALQLKFTGGEDGIQAVPRGHLFGVIDLSQSMAMYYTVLAV
FLFGFAVIWRTVHSPFGQVLKAIRENEPRAISLGYRTDHYKLMAFVLSATLAGLAGGTKA
IVFQLATLTDVQWQMSGAVVLMTLLGGIGTLFGPVVGAALVVTLENYLAASNLPVPVVIG
VIFVACVLLFRRGIVGEIAARFGGKRP