Protein Info for AZOBR_RS08355 in Azospirillum brasilense Sp245

Annotation: replicative DNA helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 510 TIGR00665: replicative DNA helicase" amino acids 33 to 501 (469 residues), 521.9 bits, see alignment E=6.5e-161 PF00772: DnaB" amino acids 33 to 134 (102 residues), 101.7 bits, see alignment E=3.2e-33 PF03796: DnaB_C" amino acids 211 to 498 (288 residues), 350.3 bits, see alignment E=8.7e-109 PF13481: AAA_25" amino acids 225 to 397 (173 residues), 58.8 bits, see alignment E=8.7e-20

Best Hits

KEGG orthology group: K02314, replicative DNA helicase [EC: 3.6.4.12] (inferred from 82% identity to azl:AZL_e01730)

Predicted SEED Role

"Replicative DNA helicase (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.12

Use Curated BLAST to search for 3.6.1.- or 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8ALL3 at UniProt or InterPro

Protein Sequence (510 amino acids)

>AZOBR_RS08355 replicative DNA helicase (Azospirillum brasilense Sp245)
MDDKTTQLFEPRPLDGGLSRAAAVKPTAEYRTPPHNEEAEQALLGAILVNNKAYEKVGEF
LRAEHFYDPAHQRIFSAIAKMVERGQIANPVTLKAYFDNDVELAPDGGAGYLAQLAANVV
TVVNAGDYGKTIHDLFLRRQLIEVGTDMVNEAYQHDLDIDAMDQIETAEKQLFDLASTGD
VRGGFIAFSESLKAAIATAETAFRRSSHVTGVTTGLRDMDRKLGGLHPSDLIILAGRPSM
GKTALATNIAFNAAKAHMRTNGGEGAPVGFFSLEMSAEQLATRILAGEAEVSGDKIRRGE
IKDSDFPKFVAASQELSRVPFFVDDTPALTIAAVRTRCRRLKRTHGLGMVVVDYLQLLRG
SSTKGNENRVQEISEITRGLKAIAKELEVPVLALSQLSRAVEMREDKRPQLADLRESGSI
EQDADVVMFVYREQYYLERGEPARRPEESEDKYNDRYANWQRRYAEVHNTAEAIIAKQRH
GPIGSVRMFFDGQFTKFGDLDTTHDFGPTE