Protein Info for AZOBR_RS08170 in Azospirillum brasilense Sp245

Annotation: carbon-nitrogen family hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 TIGR03381: N-carbamoylputrescine amidase" amino acids 9 to 286 (278 residues), 477.2 bits, see alignment E=7.8e-148 PF00795: CN_hydrolase" amino acids 10 to 270 (261 residues), 197.9 bits, see alignment E=9.7e-63

Best Hits

Swiss-Prot: 68% identical to AGUB_SOLLC: N-carbamoylputrescine amidase (CPA) from Solanum lycopersicum

KEGG orthology group: K12251, N-carbamoylputrescine amidase [EC: 3.5.1.53] (inferred from 81% identity to azl:AZL_013290)

MetaCyc: 70% identical to N-carbamoylputrascine amidohydrolase subunit (Pseudomonas aeruginosa)
N-carbamoylputrescine amidase. [EC: 3.5.1.53]

Predicted SEED Role

"N-carbamoylputrescine amidase (3.5.1.53)" in subsystem Arginine and Ornithine Degradation or Polyamine Metabolism

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.53

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8ALH1 at UniProt or InterPro

Protein Sequence (298 amino acids)

>AZOBR_RS08170 carbon-nitrogen family hydrolase (Azospirillum brasilense Sp245)
MRPTTGRTVTVAATQMACGWDRDANVNGVERLVRDAAARGAQIILPQELFETPYFCKDQK
QDLFALAHPVEDHPVIARMSALARELSVVIPTSFFERARNAYYNSLAMIDADGTVLGVYR
KSHIPDGPGYQEKYYFNPGDTGFQVYKTRYAAIGCAICWDQWFPESARAMALKGAEILFY
PTAIGSEPQDGALDSQAHWTRVMQGHAGANLMPLVASNRIGREEGDTCGITFYGSSFIAG
PTGELVAQADRDSETVLTASFDLDRIAAQRASWGIFRDRRPELYGPLLTLDGESPVRR