Protein Info for AZOBR_RS08090 in Azospirillum brasilense Sp245

Annotation: urease accessory protein UreG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00101: urease accessory protein UreG
  • amino acids 13 to 204 (192 residues), 346.6 bits, E=2.1e-108
• PF02492: cobW
  • amino acids 15 to 185 (171 residues), 138.1 bits, E=1.3e-44

Best Hits

Swiss-Prot: 83% identical to UREG_METSB: Urease accessory protein UreG (ureG) from Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)

KEGG orthology group: K03189, urease accessory protein (inferred from 93% identity to azl:AZL_021820)

MetaCyc: 68% identical to urease accessory protein GTPase UreG (Helicobacter pylori 26695)

Predicted SEED Role

"Urease accessory protein UreG" in subsystem Urea decomposition

MetaCyc Pathways

• urea degradation II (1/1 steps found)
• superpathway of allantoin degradation in plants (1/8 steps found)

Sequence Analysis Tools

See G8ALF1 at UniProt or InterPro

Protein Sequence (212 amino acids)

>AZOBR_RS08090 urease accessory protein UreG (Azospirillum brasilense Sp245)
MTAPISKSHGGPLRVGIGGPVGSGKTALTDALCKRMRDDWEVAAITNDIYTKEDAEFLTR
SGALKPDRIMGVETGGCPHTAIREDASINLAAVDEMNRKFPNLDLIFVESGGDNLAATFS
PELADLTIYVIDVSAGDKIPRKGGPGITRSDLLVINKIDLAPLVGASLEVMDRDAKKMRG
DRPFVFTNIKTGQGVDAVQSFIVQRGGLPLPG