Protein Info for AZOBR_RS07840 in Azospirillum brasilense Sp245

Annotation: fructose 1 6-bisphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 TIGR00330: fructose-1,6-bisphosphatase, class II" amino acids 1 to 320 (320 residues), 362.3 bits, see alignment E=1.2e-112 PF03320: FBPase_glpX" amino acids 3 to 312 (310 residues), 462.1 bits, see alignment E=3.4e-143

Best Hits

Swiss-Prot: 55% identical to GLPX_BACSU: Fructose-1,6-bisphosphatase class 2 (glpX) from Bacillus subtilis (strain 168)

KEGG orthology group: K02446, fructose-1,6-bisphosphatase II [EC: 3.1.3.11] (inferred from 95% identity to azl:AZL_010940)

Predicted SEED Role

"Fructose-1,6-bisphosphatase, GlpX type (EC 3.1.3.11)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 3.1.3.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AL92 at UniProt or InterPro

Protein Sequence (321 amino acids)

>AZOBR_RS07840 fructose 1 6-bisphosphatase (Azospirillum brasilense Sp245)
MDRNLALEAVRVTEAAALSASLLMGRGDEKLADQAAVDAMRQALNTLYIDGTVVIGEGER
DEAPMLYIGEKVGAGIGRGPKVDIALDPLEGTTICATGGPNSLAVIAMADEGGFLNAPDV
YMDKIAVGSGLPEGVVDLDETPANNLKALAKAKGTEVQELLVCILNRPRHAELIARVREA
GARIMLINDGDVSGVIATSQAGTGVDMYVGSGGAPEGVLAAAALRCIGGQFQGRLLFRND
DEKARAARWGVKDLNKKYSLTELASGNVMFAATGVTDGAMLRGVRRFPGGATTHSVIMRS
KSGTVRYVEAHHNLQRKPSMA