Protein Info for AZOBR_RS07835 in Azospirillum brasilense Sp245

Annotation: homoserine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 PF03447: NAD_binding_3" amino acids 16 to 135 (120 residues), 68 bits, see alignment E=1.8e-22 PF00742: Homoserine_dh" amino acids 144 to 322 (179 residues), 222.2 bits, see alignment E=6.1e-70

Best Hits

Swiss-Prot: 43% identical to DHOM_HELPJ: Homoserine dehydrogenase (hom) from Helicobacter pylori (strain J99 / ATCC 700824)

KEGG orthology group: K00003, homoserine dehydrogenase [EC: 1.1.1.3] (inferred from 83% identity to azl:AZL_010930)

Predicted SEED Role

"Homoserine dehydrogenase (EC 1.1.1.3)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 1.1.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8AL91 at UniProt or InterPro

Protein Sequence (435 amino acids)

>AZOBR_RS07835 homoserine dehydrogenase (Azospirillum brasilense Sp245)
MSDSHKTGPLKIAVAGLGTVGAGVLKLLERQADLIEQRCGRRIEVVAVSARSRGKDRGVD
LSKAEWYDDPVALAAHPGVDVVVELIGGSEGAAKETVELALERGRHVVTANKALLAHHGT
ALAAKAEAAGLAIGFEAAVAGGIPIIKGLREGLAANRVSEVHGILNGTCNYILTEMRTTG
RDFADVLADAQKLGYAEADPSFDIDGVDAAHKLAILTSVAFGTPVDFKSVHVEGIRHVSA
VDFDYADALGYRIKLLGIARRTDHGIEQRVHPCMVPKAAPIAAVDGVFNAVIAQGDFVDR
VLFVGRGAGEGPTASAVVADLIDIARGRSTPTFGVPAAQLSEAQPSPMEARRGSYYVRLM
VVDRPGVIADVAAAMRDQNVSMEQFLQRGRAPGEAVPVVLTTHDTEEAAMQRALATIADK
ESVVEPPRMIRIEQF